General Information

  • ID:  hor006745
  • Uniprot ID:  P69062
  • Protein name:  Glycoprotein hormones alpha chain 2
  • Gene name:  cgab
  • Organism:  Oncorhynchus tshawytscha (Chinook salmon) (Salmo tshawytscha)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPNSDKTNMGCEECTLKPNTIFPNIMQCTGCCFSRAYPTPLRSKQTMLVPKNITSEATCCVAKEGERVTTKDGFPVTNHTECHCSTCYYHKS
  • Length:  92(23-114)
  • Propeptide:  MCLLKSTGLSLILSALLVIADSYPNSDKTNMGCEECTLKPNTIFPNIMQCTGCCFSRAYPTPLRSKQTMLVPKNITSEATCCVAKEGERVTTKDGFPVTNHTECHCSTCYYHKS
  • Signal peptide:  MCLLKSTGLSLILSALLVIADS
  • Modification:  NA
  • Glycosylation:  T52 N-linked (GlcNAc...) asparagine;T78 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Involved in gametogenesis and steroidogenesis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  11-31; 14-60; 28-82; 32-84; 59-87
  • Structure ID:  AF-P69062-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006745_AF2.pdbhor006745_ESM.pdb

Physical Information

Mass: 1191706 Formula: C436H686N122O140S13
Absent amino acids: W Common amino acids: T
pI: 7.88 Basic residues: 13
Polar residues: 43 Hydrophobic residues: 16
Hydrophobicity: -56.63 Boman Index: -17752
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 41.3
Instability Index: 6138.7 Extinction Coefficient cystines: 6585
Absorbance 280nm: 72.36

Literature

  • PubMed ID:  7749461
  • Title:  A gene encoding chinook salmon (Oncorhynchus tschawytscha) gonadotropin alpha subunit: gene structure and promoter analysis in primary pituitary cells.